Lineage for d2qr2a_ (2qr2 A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.5: Flavoproteins [52218] (3 families) 
Family c.23.5.3: Quinone reductase [52235] (2 proteins) 
Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52241] (2 PDB entries) 
Domain d2qr2a_: 2qr2 A: [31233]
Details for d2qr2a_
PDB Entry: 2qr2 (more details), 2.45 Å
PDB Description: human quinone reductase type 2, complex with menadione
SCOP Domain Sequences for d2qr2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qr2a_ c.23.5.3 (A:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens)}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq
SCOP Domain Coordinates for d2qr2a_:
Click to download the PDB-style file with coordinates for d2qr2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2qr2a_:
- d2qr2a_ appears in SCOP 1.57
- d2qr2a_ appears in the current release, SCOPe 2.08
View in 3D
