SCOPe 2.08: Domain d2qr2a_: 2qr2 A:

Lineage for d2qr2a_ (2qr2 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.3: Quinone reductase [52235] (4 proteins)
   binds FAD

6. Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52241] (66 PDB entries)

8. Domain d2qr2a_: 2qr2 A: [31233]
   complexed with fad, vk3, zn

Details for d2qr2a_

PDB Entry: 2qr2, 2.45 Å

PDB Description: human quinone reductase type 2, complex with menadione

PDB Compounds: (A:) protein (quinone reductase type 2)

SCOPe Domain Sequences for d2qr2a_:

Sequence; same for both SEQRES and ATOM records:

>d2qr2a_ c.23.5.3 (A:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq

Timeline for d2qr2a_:

• d2qr2a_ first appeared (with stable ids) in SCOP 1.55
  
• d2qr2a_ appears in SCOPe 2.07