Lineage for d4z5sa_ (4z5s A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703838Family a.25.1.6: PMT1231-like [158402] (2 proteins)
    PfamB PB016165
    automatically mapped to Pfam PF11266
  6. 2703849Protein automated matches [261918] (5 species)
    not a true protein
  7. 2703873Species Synechocystis sp. [TaxId:1111708] [312327] (1 PDB entry)
  8. 2703874Domain d4z5sa_: 4z5s A: [312328]
    automated match to d4quwa_

Details for d4z5sa_

PDB Entry: 4z5s (more details), 1.58 Å

PDB Description: crystal structure of apo-form of aldehyde deformylating oxygenase from synechocystis sp.pcc 6803
PDB Compounds: (A:) Aldehyde decarbonylase

SCOPe Domain Sequences for d4z5sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z5sa_ a.25.1.6 (A:) automated matches {Synechocystis sp. [TaxId: 1111708]}
vrtefdysseiykdaysrinaiviegeqeaysnylqmaellpedkeeltrlakmenrhkk
gfqacgnnlqvnpdmpyaqeffaglhgnfqhafsegkvvtclliqaliieafaiaayniy
ipvaddfarkitegvvkdeythlnygeewlkanfatakeeleqankenlplvwkmlnqvq
gdakvlgmekealvedfmisygealsnigfstreimrmssygl

SCOPe Domain Coordinates for d4z5sa_:

Click to download the PDB-style file with coordinates for d4z5sa_.
(The format of our PDB-style files is described here.)

Timeline for d4z5sa_: