Lineage for d1qr2b_ (1qr2 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1838447Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1838601Family c.23.5.3: Quinone reductase [52235] (4 proteins)
    binds FAD
  6. 1838657Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)
  7. 1838658Species Human (Homo sapiens) [TaxId:9606] [52241] (53 PDB entries)
  8. 1838751Domain d1qr2b_: 1qr2 B: [31232]
    complexed with fad, zn

Details for d1qr2b_

PDB Entry: 1qr2 (more details), 2.1 Å

PDB Description: human quinone reductase type 2
PDB Compounds: (B:) protein (quinone reductase type 2)

SCOPe Domain Sequences for d1qr2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qr2b_ c.23.5.3 (B:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens) [TaxId: 9606]}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq

SCOPe Domain Coordinates for d1qr2b_:

Click to download the PDB-style file with coordinates for d1qr2b_.
(The format of our PDB-style files is described here.)

Timeline for d1qr2b_: