![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Unidentified influenza virus [TaxId:119212] [312272] (6 PDB entries) |
![]() | Domain d4yy0e_: 4yy0 E: [312310] Other proteins in same PDB: d4yy0b_, d4yy0d_, d4yy0f_ automated match to d4xkgc_ complexed with nag |
PDB Entry: 4yy0 (more details), 2.59 Å
SCOPe Domain Sequences for d4yy0e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yy0e_ b.19.1.0 (E:) automated matches {Unidentified influenza virus [TaxId: 119212]} dkicigyhannsttqvdtlleknvtvthsvellenqkekrfckimnkapldlkdctiegw ilgnpkcdlllgdqswsyiverpnaqngicypgvlneleelkafigsgerverfemfpks twagvdtsrgvtnacpsytldssfyrnlvwlvktdsatypvikgtynntgtqpilyfwgv hhppdttvqdnlygsgdkyvrmgtesmnfakspeiaarpavngqrsridyywsvlrpget lnvesngnliapwyaykfvstnkkgavfksdlpiencdatcqtiagvlktnktfqnvspl wigecpkyvkseslrlatglrnvpq
Timeline for d4yy0e_: