Lineage for d1qr2a_ (1qr2 A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 120208Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 120383Superfamily c.23.5: Flavoproteins [52218] (3 families) (S)
  5. 120474Family c.23.5.3: Quinone reductase [52235] (2 proteins)
  6. 120517Protein Quinone reductase type 2 (menadione reductase) [52240] (1 species)
  7. 120518Species Human (Homo sapiens) [TaxId:9606] [52241] (2 PDB entries)
  8. 120519Domain d1qr2a_: 1qr2 A: [31231]

Details for d1qr2a_

PDB Entry: 1qr2 (more details), 2.1 Å

PDB Description: human quinone reductase type 2

SCOP Domain Sequences for d1qr2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qr2a_ c.23.5.3 (A:) Quinone reductase type 2 (menadione reductase) {Human (Homo sapiens)}
agkkvlivyahqepksfngslknvavdelsrqgctvtvsdlyamnfepratdkditgtls
npevfnygvetheaykqrslasditdeqkkvreadlvifqfplywfsvpailkgwmdrvl
cqgfafdipgfydsgllqgklallsvttggtaemytktgvngdsryflwplqhgtlhfcg
fkvlapqisfapeiaseeerkgmvaawsqrlqtiwkeepipctahwhfgq

SCOP Domain Coordinates for d1qr2a_:

Click to download the PDB-style file with coordinates for d1qr2a_.
(The format of our PDB-style files is described here.)

Timeline for d1qr2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qr2b_