Lineage for d4z10a_ (4z10 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719416Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2719417Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2719484Family a.86.1.0: automated matches [254307] (1 protein)
    not a true family
  6. 2719485Protein automated matches [254708] (4 species)
    not a true protein
  7. 2719529Species Coreopsis grandiflora [TaxId:13449] [312215] (3 PDB entries)
  8. 2719538Domain d4z10a_: 4z10 A: [312309]
    automated match to d1bt3a_
    complexed with act, cu, gol, rco

Details for d4z10a_

PDB Entry: 4z10 (more details), 1.93 Å

PDB Description: inactive aurone synthase (polyphenol oxidase) co-crystallized with 1, 4-resorcinol
PDB Compounds: (A:) Aurone synthase

SCOPe Domain Sequences for d4z10a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z10a_ a.86.1.0 (A:) automated matches {Coreopsis grandiflora [TaxId: 13449]}
apitapditsickdassgignqegairtrkccppslgkkikdfqfpndkkvrmrwpahkg
tkkqvddyrraiaamralpdddprsfvsqakihcaycnggytqvdsgfpdidiqihnswl
ffpfhrwylyfyerilgslidepnfalpywkwdepkgmpisniflgdasnplydqyrdan
hiedrivdldydgkdkdipdqqqvacnlstvyrdlvrngvdptsffggkyvagdspvang
dpsvgsveagsxtavhrwvgdptqpnnedmgnfysagydpvfyihhanvdrmwklwkelr
lpghvditdpdwlnasyvfydenkdlvrvynkdcvnldklkynfien

SCOPe Domain Coordinates for d4z10a_:

Click to download the PDB-style file with coordinates for d4z10a_.
(The format of our PDB-style files is described here.)

Timeline for d4z10a_: