SCOPe 2.06: Domain d4ycda_: 4ycd A:

Lineage for d4ycda_ (4ycd A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families)

5. Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 proteins)
   automatically mapped to Pfam PF00731

6. Protein automated matches [191111] (3 species)
   not a true protein

7. Species Acetobacter aceti [TaxId:1457393] [311949] (18 PDB entries)

8. Domain d4ycda_: 4ycd A: [312308]
   automated match to d1u11b_
   complexed with act, edo, so4; mutant

Details for d4ycda_

PDB Entry: 4ycd, 1.64 Å

PDB Description: structure of a single tryptophan mutant of acetobacter aceti pure with y154f

PDB Compounds: (A:) N5-carboxyaminoimidazole ribonucleotide mutase

SCOPe Domain Sequences for d4ycda_:

Sequence; same for both SEQRES and ATOM records:

>d4ycda_ c.23.8.1 (A:) automated matches {Acetobacter aceti [TaxId: 1457393]}
sapvvgiimgsqsdfetmrhadallteleiphetlivsahrtpdrladyartaaerglnv
iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
aknaallaasilalfnpalaarletfralqtasvpnspit

Timeline for d4ycda_:

• d4ycda_ is new in SCOPe 2.06-stable
  
• d4ycda_ appears in SCOPe 2.07
  
• d4ycda_ appears in the current release, SCOPe 2.08