SCOPe 2.08: Domain d4z69i1: 4z69 I:3-196

Lineage for d4z69i1 (4z69 I:3-196)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (96 PDB entries)
   Uniprot P02768 29-596

8. Domain d4z69i1: 4z69 I:3-196 [312290]
   automated match to d1n5ua1
   complexed with dif, f15, plm

Details for d4z69i1

PDB Entry: 4z69, 2.19 Å

PDB Description: human serum albumin complexed with palmitic acid and diclofenac

PDB Compounds: (I:) serum albumin

SCOPe Domain Sequences for d4z69i1:

Sequence; same for both SEQRES and ATOM records:

>d4z69i1 a.126.1.1 (I:3-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
hksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaenc
dkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevdv
mctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpkl
delrdegkassakq

Timeline for d4z69i1:

• d4z69i1 first appeared in SCOPe 2.06
  
• d4z69i1 appears in SCOPe 2.07