Lineage for d4yyya3 (4yyy A:336-440)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2944850Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 2945237Superfamily d.41.3: Pyrimidine nucleoside phosphorylase C-terminal domain [54680] (2 families) (S)
  5. 2945255Family d.41.3.0: automated matches [254277] (1 protein)
    not a true family
  6. 2945256Protein automated matches [254643] (6 species)
    not a true protein
  7. 2945274Species Salmonella typhimurium [TaxId:99287] [311467] (3 PDB entries)
  8. 2945279Domain d4yyya3: 4yyy A:336-440 [312282]
    Other proteins in same PDB: d4yyya1, d4yyya2, d4yyyb1, d4yyyb2
    automated match to d4x46b3
    complexed with cit, pge, uri

Details for d4yyya3

PDB Entry: 4yyy (more details), 2.43 Å

PDB Description: x-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with uridine
PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d4yyya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yyya3 d.41.3.0 (A:336-440) automated matches {Salmonella typhimurium [TaxId: 99287]}
tamlskavyadtegfisamdtralgmavvsmgggrrqasdtidysvgftdmarlgdsidg
qrplavihakdeaswqeaakavkaaiilddkapastpsvyrrite

SCOPe Domain Coordinates for d4yyya3:

Click to download the PDB-style file with coordinates for d4yyya3.
(The format of our PDB-style files is described here.)

Timeline for d4yyya3: