SCOPe 2.08: Domain d4yyya1: 4yyy A:1-70

Lineage for d4yyya1 (4yyy A:1-70)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families)
   automatically mapped to Pfam PF02885

5. Family a.46.2.0: automated matches [254276] (1 protein)
   not a true family

6. Protein automated matches [254641] (6 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [311465] (3 PDB entries)

8. Domain d4yyya1: 4yyy A:1-70 [312280]
   Other proteins in same PDB: d4yyya2, d4yyya3, d4yyyb2, d4yyyb3
   automated match to d4x46b1
   complexed with cit, pge, uri

Details for d4yyya1

PDB Entry: 4yyy, 2.43 Å

PDB Description: x-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with uridine

PDB Compounds: (A:) thymidine phosphorylase

SCOPe Domain Sequences for d4yyya1:

Sequence; same for both SEQRES and ATOM records:

>d4yyya1 a.46.2.0 (A:1-70) automated matches {Salmonella typhimurium [TaxId: 99287]}
mflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
mamrdsgtvl

Timeline for d4yyya1:

• d4yyya1 first appeared in SCOPe 2.06
  
• d4yyya1 appears in SCOPe 2.07