SCOPe 2.08: Domain d4xcni1: 4xcn I:1-106

Lineage for d4xcni1 (4xcn I:1-106)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (24 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
Domain d4xcni1: 4xcn I:1-106 [312277]
Other proteins in same PDB: d4xcnb2, d4xcnd2, d4xcnf2, d4xcni2, d4xcnk2, d4xcnl2
automated match to d1dn0a1
complexed with 44e, gol, po4, unl

Details for d4xcni1

PDB Entry: 4xcn (more details), 2.9 Å

PDB Description: crystal structure of human 4e10 fab in complex with phosphatidic acid (06:0 pa); 2.9 a resolution

PDB Compounds: (I:) 4E10 Fab light chain

SCOPe Domain Sequences for d4xcni1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xcni1 b.1.1.1 (I:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtqslspgeratlscrasqsvgnnklawyqqrpgqaprlliygassrpsgva
drfsgsgsgtdftltisrlepedfavyycqqygqslstfgqgtkvev

SCOPe Domain Coordinates for d4xcni1:

Click to download the PDB-style file with coordinates for d4xcni1.
(The format of our PDB-style files is described here.)

Timeline for d4xcni1: