Lineage for d1qbga_ (1qbg A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2115525Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2115683Family c.23.5.3: Quinone reductase [52235] (4 proteins)
    binds FAD
  6. 2115697Protein NAD(P)H:quinone reductase [52236] (3 species)
  7. 2115698Species Human (Homo sapiens) [TaxId:9606] [52239] (8 PDB entries)
  8. 2115715Domain d1qbga_: 1qbg A: [31227]
    complexed with fad

Details for d1qbga_

PDB Entry: 1qbg (more details), 2.3 Å

PDB Description: crystal structure of human dt-diaphorase (nad(p)h oxidoreductase)
PDB Compounds: (A:) nad(p)h dehydrogenase [quinone] 1

SCOPe Domain Sequences for d1qbga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbga_ c.23.5.3 (A:) NAD(P)H:quinone reductase {Human (Homo sapiens) [TaxId: 9606]}
vrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkd
panfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfi
gefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgf
qvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkke
vqdeeknkkfglsvghhlgksiptdnqikark

SCOPe Domain Coordinates for d1qbga_:

Click to download the PDB-style file with coordinates for d1qbga_.
(The format of our PDB-style files is described here.)

Timeline for d1qbga_: