Lineage for d1qbga_ (1qbg A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68133Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 68298Superfamily c.23.5: Flavoproteins [52218] (3 families) (S)
  5. 68387Family c.23.5.3: Quinone reductase [52235] (2 proteins)
  6. 68388Protein NAD(P)H:quinone reductase [52236] (3 species)
  7. 68389Species Human (Homo sapiens) [TaxId:9606] [52239] (6 PDB entries)
  8. 68410Domain d1qbga_: 1qbg A: [31227]

Details for d1qbga_

PDB Entry: 1qbg (more details), 2.3 Å

PDB Description: crystal structure of human dt-diaphorase (nad(p)h oxidoreductase)

SCOP Domain Sequences for d1qbga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qbga_ c.23.5.3 (A:) NAD(P)H:quinone reductase {Human (Homo sapiens)}
vrralivlahsertsfnyamkeaaaaalkkkgwevvesdlyamnfnpiisrkditgklkd
panfqypaesvlaykeghlspdivaeqkkleaadlvifqfplqwfgvpailkgwfervfi
gefaytyaamydkgpfrskkavlsittggsgsmyslqgihgdmnvilwpiqsgilhfcgf
qvlepqltysightpadariqilegwkkrleniwdetplyfapsslfdlnfqagflmkke
vqdeeknkkfglsvghhlgksiptdnqikark

SCOP Domain Coordinates for d1qbga_:

Click to download the PDB-style file with coordinates for d1qbga_.
(The format of our PDB-style files is described here.)

Timeline for d1qbga_: