Lineage for d4yxga_ (4yxg A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2413228Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2413229Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 proteins)
    automatically mapped to Pfam PF00121
  6. 2413230Protein Triosephosphate isomerase [51353] (20 species)
  7. 2413311Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [51359] (31 PDB entries)
    Uniprot Q07412
  8. 2413360Domain d4yxga_: 4yxg A: [312259]
    automated match to d2vffa_
    complexed with edo; mutant

Details for d4yxga_

PDB Entry: 4yxg (more details), 1.9 Å

PDB Description: f96y mutant of plasmodium falciparum triosephosphate isomerase
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d4yxga_:

Sequence, based on SEQRES records: (download)

>d4yxga_ c.1.1.1 (A:) Triosephosphate isomerase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
arkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfst
giqnvskfgngsytgevsaeiakdlnieyviighyerrkyfhetdedvreklqaslknnl
kavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaigtgktatpeqa
qlvhkeirkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfv
diiksam

Sequence, based on observed residues (ATOM records): (download)

>d4yxga_ c.1.1.1 (A:) Triosephosphate isomerase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
arkyfvaanwkcngtlesiksltnsfnnldfdpskldvvvfpvsvhydhtrkllqskfst
giqnvskfgngsytgevsaeiakdlnieyviighyerrkyfhetdedvreklqaslknnl
kavvcfgesleqreqnktievitkqvkafvdlidnfdnvilvyeplwaatpeqaqlvhke
irkivkdtcgekqanqirilyggsvntencssliqqedidgflvgnaslkesfvdiiksa
m

SCOPe Domain Coordinates for d4yxga_:

Click to download the PDB-style file with coordinates for d4yxga_.
(The format of our PDB-style files is described here.)

Timeline for d4yxga_: