Lineage for d4ybrb1 (4ybr B:4-200)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2468309Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2469071Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2469072Protein automated matches [190459] (59 species)
    not a true protein
  7. 2469307Species Mycobacterium tuberculosis [TaxId:83332] [269137] (14 PDB entries)
  8. 2469309Domain d4ybrb1: 4ybr B:4-200 [312245]
    Other proteins in same PDB: d4ybra2, d4ybrb2
    automated match to d1yula_
    complexed with cl, epe, nap, so4

Details for d4ybrb1

PDB Entry: 4ybr (more details), 1.65 Å

PDB Description: structure of mycobacterium tuberculosis nadd in complex with nadp, p21212
PDB Compounds: (B:) nicotinate-nucleotide adenylyltransferase

SCOPe Domain Sequences for d4ybrb1:

Sequence, based on SEQRES records: (download)

>d4ybrb1 c.26.1.0 (B:4-200) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
rrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpwqkgrqvsaaehrylmtvi
atasnprfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimswqgweel
felarfvgvsrpgyelrnehitsllgqlakdaltlveipalaisstdcrqraeqsrplwy
lmpdgvvqyvskrrlyt

Sequence, based on observed residues (ATOM records): (download)

>d4ybrb1 c.26.1.0 (B:4-200) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
rrlgvmggtfdpihyghlvaasevadlfdldevvfvpsgqpwgrqvsaaehrylmtviat
asnprfsvsrvdidrggptytkdtladlhalhpdselyfttgadalasimsweelfelar
fvgvsrpgyelrnehitsllgqlakdaltlveipalaisstdcrqraeqsrplwylmpdg
vvqyvskrrlyt

SCOPe Domain Coordinates for d4ybrb1:

Click to download the PDB-style file with coordinates for d4ybrb1.
(The format of our PDB-style files is described here.)

Timeline for d4ybrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ybrb2