| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (15 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
| Domain d4yc2l2: 4yc2 L:106A-208 [312244] Other proteins in same PDB: d4yc2b1, d4yc2b2, d4yc2c1, d4yc2h1, d4yc2h2, d4yc2l1 automated match to d4ocrl2 |
PDB Entry: 4yc2 (more details), 3.02 Å
SCOPe Domain Sequences for d4yc2l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yc2l2 b.1.1.2 (L:106A-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttps
kqsnnkyaassylsltpeqwkshrsyscqvthegstvektvap
Timeline for d4yc2l2: