SCOPe 2.08: Domain d4yc2l2: 4yc2 L:106A-208

Lineage for d4yc2l2 (4yc2 L:106A-208)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d4yc2l2: 4yc2 L:106A-208 [312244]
Other proteins in same PDB: d4yc2b1, d4yc2b2, d4yc2c1, d4yc2h1, d4yc2h2, d4yc2l1
automated match to d4ocrl2

Details for d4yc2l2

PDB Entry: 4yc2 (more details), 3.02 Å

PDB Description: crystal structure of the stabilized inner domain of clade a/e hiv-1 gp120 from e. coli in complex with the antibody a32.

PDB Compounds: (L:) The antibody A32 Fab light chain.

SCOPe Domain Sequences for d4yc2l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yc2l2 b.1.1.2 (L:106A-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lgqpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttps
kqsnnkyaassylsltpeqwkshrsyscqvthegstvektvap

SCOPe Domain Coordinates for d4yc2l2:

Click to download the PDB-style file with coordinates for d4yc2l2.
(The format of our PDB-style files is described here.)

Timeline for d4yc2l2: