SCOPe 2.08: Domain d4yc2l1: 4yc2 L:4-106

Lineage for d4yc2l1 (4yc2 L:4-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4yc2l1: 4yc2 L:4-106 [312243]
   Other proteins in same PDB: d4yc2b2, d4yc2c2, d4yc2h2, d4yc2l2
   automated match to d4ocrl1

Details for d4yc2l1

PDB Entry: 4yc2, 3.02 Å

PDB Description: crystal structure of the stabilized inner domain of clade a/e hiv-1 gp120 from e. coli in complex with the antibody a32.

PDB Compounds: (L:) The antibody A32 Fab light chain.

SCOPe Domain Sequences for d4yc2l1:

Sequence; same for both SEQRES and ATOM records:

>d4yc2l1 b.1.1.0 (L:4-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vltqppsasgspgqsvtisctgtssdvggynyvswyqhhpgkapkliisevnnrpsgvpd
rfsgsksgntasltvsglqaedeaeyycssytdihnfvfgggtkltv

Timeline for d4yc2l1:

• d4yc2l1 first appeared in SCOPe 2.06
  
• d4yc2l1 appears in SCOPe 2.07