![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
![]() | Domain d4yc2l1: 4yc2 L:4-106 [312243] Other proteins in same PDB: d4yc2b2, d4yc2c2, d4yc2h2, d4yc2l2 automated match to d4ocrl1 |
PDB Entry: 4yc2 (more details), 3.02 Å
SCOPe Domain Sequences for d4yc2l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yc2l1 b.1.1.0 (L:4-106) automated matches {Human (Homo sapiens) [TaxId: 9606]} vltqppsasgspgqsvtisctgtssdvggynyvswyqhhpgkapkliisevnnrpsgvpd rfsgsksgntasltvsglqaedeaeyycssytdihnfvfgggtkltv
Timeline for d4yc2l1: