Lineage for d4yb6c2 (4yb6 C:225-299)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.5: GlnB-like [54913] (6 families) 
form timeric structures with the orthogonally packed beta-sheets
Family d.58.5.0: automated matches [191474] (1 protein)
not a true familyProtein automated matches [190753] (21 species)
not a true protein
Species Campylobacter jejuni [TaxId:195099] [311910] (3 PDB entries) 
Domain d4yb6c2: 4yb6 C:225-299 [312240]
Other proteins in same PDB: d4yb6a1, d4yb6b1, d4yb6c1, d4yb6d1, d4yb6e1, d4yb6f1
automated match to d1h3da2
complexed with amp, his, mg, peg
Details for d4yb6c2
PDB Entry: 4yb6 (more details), 1.98 Å
PDB Description: adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with the inhibitors amp and histidine
PDB Compounds: (C:) ATP phosphoribosyltransferaseSCOPe Domain Sequences for d4yb6c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yb6c2 d.58.5.0 (C:225-299) automated matches {Campylobacter jejuni [TaxId: 195099]}
eskyimlhapkekldkiqallpgverptilplahdeknvalhmvskenlfwetmealkee
gassilvlpiekmlk
SCOPe Domain Coordinates for d4yb6c2:
Click to download the PDB-style file with coordinates for d4yb6c2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4yb6c2:
View in 3D
