| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
| Protein automated matches [190039] (158 species) not a true protein |
| Species Campylobacter jejuni [TaxId:195099] [311908] (7 PDB entries) |
| Domain d4yb6c1: 4yb6 C:5-224 [312239] Other proteins in same PDB: d4yb6a2, d4yb6b2, d4yb6c2, d4yb6d2, d4yb6e2, d4yb6f2 automated match to d1h3da1 complexed with amp, his, mg, peg |
PDB Entry: 4yb6 (more details), 1.98 Å
SCOPe Domain Sequences for d4yb6c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yb6c1 c.94.1.0 (C:5-224) automated matches {Campylobacter jejuni [TaxId: 195099]}
trlriaiqksgrlskesiellsecgvkmhiheqsliafstnlpidilrvrdddipglifd
gvvdlgiigenvleenelerqslgenpsykllkkldfgycrlslalpqenkfqnlkdfeg
lriatsypqllkrfmkenginyknctltgsvevapranladaicdlvssgatlqannlke
vkviyesracliqkenalskekqalvdkimlrvagvmqar
Timeline for d4yb6c1: