SCOPe 2.08: Domain d4ynyb1: 4yny B:20-129

Lineage for d4ynyb1 (4yny B:20-129)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (19 PDB entries)

8. Domain d4ynyb1: 4yny B:20-129 [312237]
   Other proteins in same PDB: d4ynya_, d4ynyc_
   automated match to d2mcg11

Details for d4ynyb1

PDB Entry: 4yny, 1.58 Å

PDB Description: crystal structure of monoclonal anti-human podoplanin antibody nz-1

PDB Compounds: (B:) Light chain of antigen binding fragment, Fab

SCOPe Domain Sequences for d4ynyb1:

Sequence; same for both SEQRES and ATOM records:

>d4ynyb1 b.1.1.0 (B:20-129) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
efvltqpnsvstnlgstvklsckrstgnigsnyvnwyqqhegrspttmiyrddkrpdgvp
drfsgsidrssnsalltinnvqtedeadyfchsyssgivfgggtkltvlg

Timeline for d4ynyb1:

• d4ynyb1 first appeared in SCOPe 2.06
  
• d4ynyb1 appears in SCOPe 2.07