| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) ![]() contains two Fe4-S4 clusters |
| Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
| Protein automated matches [231469] (5 species) not a true protein |
| Species Pig (Sus scrofa) [TaxId:9823] [255744] (5 PDB entries) |
| Domain d4yxdb2: 4yxd B:115-247 [312229] Other proteins in same PDB: d4yxdb1, d4yxdd_ automated match to d1zoyb2 complexed with f3s, fad, fes, ftn, hem, sf4 |
PDB Entry: 4yxd (more details), 3 Å
SCOPe Domain Sequences for d4yxdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yxdb2 a.1.2.1 (B:115-247) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
lsnfyaqyksiepylkkkdesqegkqqylqsieerekldglyecilcaccstscpsywwn
gdkylgpavlmqayrwmidsrddfteerlaklqdpfslyrchtimnctgtcpkglnpgka
iaeikkmmatyke
Timeline for d4yxdb2: