Lineage for d4yxdb2 (4yxd B:115-247)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2689591Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) (S)
    contains two Fe4-S4 clusters
  5. 2689592Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins)
  6. 2689655Protein automated matches [231469] (5 species)
    not a true protein
  7. 2689674Species Pig (Sus scrofa) [TaxId:9823] [255744] (5 PDB entries)
  8. 2689676Domain d4yxdb2: 4yxd B:115-247 [312229]
    Other proteins in same PDB: d4yxdb1, d4yxdd_
    automated match to d1zoyb2
    complexed with f3s, fad, fes, ftn, hem, sf4

Details for d4yxdb2

PDB Entry: 4yxd (more details), 3 Å

PDB Description: crystal structure of porcine heart mitochondrial complex ii bound with flutolanil
PDB Compounds: (B:) Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial

SCOPe Domain Sequences for d4yxdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yxdb2 a.1.2.1 (B:115-247) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
lsnfyaqyksiepylkkkdesqegkqqylqsieerekldglyecilcaccstscpsywwn
gdkylgpavlmqayrwmidsrddfteerlaklqdpfslyrchtimnctgtcpkglnpgka
iaeikkmmatyke

SCOPe Domain Coordinates for d4yxdb2:

Click to download the PDB-style file with coordinates for d4yxdb2.
(The format of our PDB-style files is described here.)

Timeline for d4yxdb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4yxdb1
View in 3D
Domains from other chains:
(mouse over for more information)
d4yxdd_