Lineage for d4z0mc_ (4z0m C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2112071Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2112072Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2113065Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2113066Protein automated matches [190246] (54 species)
    not a true protein
  7. 2113448Species Mycobacterium tuberculosis [TaxId:83332] [187022] (11 PDB entries)
  8. 2113467Domain d4z0mc_: 4z0m C: [312220]
    automated match to d3qkab_

Details for d4z0mc_

PDB Entry: 4z0m (more details), 1.97 Å

PDB Description: echa5 mycobacterium tuberculosis
PDB Compounds: (C:) enoyl-coa hydratase

SCOPe Domain Sequences for d4z0mc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4z0mc_ c.14.1.0 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
dlvrverkgrvttvilnrpasrnavngptaaalcaafeqfdrddaasvavlwgaggtfca
gadlkafgtpeansvhrtgpgpmgpsrmmlskpviaavsgyavagglelalwcdlrvaee
davfgvfcrrwgvplidggtvrlprlighsramdmiltgrgvpadealamglanrvvpkg
qarqaaeelaaqlaalpqqclrsdrlsalhqwglpesaaldlefasiarv

SCOPe Domain Coordinates for d4z0mc_:

Click to download the PDB-style file with coordinates for d4z0mc_.
(The format of our PDB-style files is described here.)

Timeline for d4z0mc_: