Lineage for d4ycbb_ (4ycb B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857183Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) (S)
  5. 2857184Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 proteins)
    automatically mapped to Pfam PF00731
  6. 2857234Protein automated matches [191111] (4 species)
    not a true protein
  7. 2857235Species Acetobacter aceti [TaxId:1457393] [311949] (18 PDB entries)
  8. 2857239Domain d4ycbb_: 4ycb B: [312219]
    automated match to d1u11b_
    complexed with act, edo, k, pgf, so4; mutant

Details for d4ycbb_

PDB Entry: 4ycb (more details), 1.35 Å

PDB Description: structure of a single tryptophan mutant of acetobacter aceti pure
PDB Compounds: (B:) N5-carboxyaminoimidazole ribonucleotide mutase

SCOPe Domain Sequences for d4ycbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ycbb_ c.23.8.1 (B:) automated matches {Acetobacter aceti [TaxId: 1457393]}
sapvvgiimgsqsdfetmrhadallteleiphetlivsahrtpdrladyartaaerglnv
iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
aknaallaasilalynpalaarletfralqtasvpnspitedk

SCOPe Domain Coordinates for d4ycbb_:

Click to download the PDB-style file with coordinates for d4ycbb_.
(The format of our PDB-style files is described here.)

Timeline for d4ycbb_: