| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.8: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52255] (2 families) ![]() |
| Family c.23.8.1: N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) [52256] (2 proteins) automatically mapped to Pfam PF00731 |
| Protein automated matches [191111] (4 species) not a true protein |
| Species Acetobacter aceti [TaxId:1457393] [311949] (18 PDB entries) |
| Domain d4ycbb_: 4ycb B: [312219] automated match to d1u11b_ complexed with act, edo, k, pgf, so4; mutant |
PDB Entry: 4ycb (more details), 1.35 Å
SCOPe Domain Sequences for d4ycbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ycbb_ c.23.8.1 (B:) automated matches {Acetobacter aceti [TaxId: 1457393]}
sapvvgiimgsqsdfetmrhadallteleiphetlivsahrtpdrladyartaaerglnv
iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
aknaallaasilalynpalaarletfralqtasvpnspitedk
Timeline for d4ycbb_: