SCOPe 2.06: Domain d4yy1b_: 4yy1 B:

Lineage for d4yy1b_ (4yy1 B:)

1. Root: SCOPe 2.06

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (34 species)
   not a true protein

7. Species Unidentified influenza virus [TaxId:119212] [312202] (5 PDB entries)

8. Domain d4yy1b_: 4yy1 B: [312211]
   Other proteins in same PDB: d4yy1a_, d4yy1c_
   automated match to d3s12b_
   complexed with gal, nag, sia

Details for d4yy1b_

PDB Entry: 4yy1, 3.1 Å

PDB Description: the structure of hemagglutinin from a h6n1 influenza virus (a/chicken/taiwan/a2837/2013) in complex with human receptor analog 6'slnln

PDB Compounds: (B:) ha2

SCOPe Domain Sequences for d4yy1b_:

Sequence; same for both SEQRES and ATOM records:

>d4yy1b_ h.3.1.1 (B:) automated matches {Unidentified influenza virus [TaxId: 119212]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydypkyqk

Timeline for d4yy1b_:

• d4yy1b_ is new in SCOPe 2.06-stable
  
• d4yy1b_ appears in SCOPe 2.07
  
• d4yy1b_ appears in the current release, SCOPe 2.08