| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
| Protein automated matches [196909] (83 species) not a true protein |
| Species Corallococcus coralloides [TaxId:184914] [312199] (3 PDB entries) |
| Domain d4yufa2: 4yuf A:186-335 [312208] automated match to d4v2pa2 |
PDB Entry: 4yuf (more details), 1.54 Å
SCOPe Domain Sequences for d4yufa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yufa2 c.95.1.0 (A:186-335) automated matches {Corallococcus coralloides [TaxId: 184914]}
ihasqvrtygygaefsmvpgggsrrhpngknttpednylhmngaellkigfeylprfnea
lwkqcpditikdcryviphqpsrvvldylsltypddklvriidrfancigasmpmalyea
vkvgglrrgergvltgtgsgvsfvgmvfty
Timeline for d4yufa2: