Lineage for d4yufa1 (4yuf A:6-185)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524590Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2524591Protein automated matches [196909] (81 species)
    not a true protein
  7. 2524843Species Corallococcus coralloides [TaxId:184914] [312199] (3 PDB entries)
  8. 2524846Domain d4yufa1: 4yuf A:6-185 [312207]
    automated match to d4v2pa1

Details for d4yufa1

PDB Entry: 4yuf (more details), 1.54 Å

PDB Description: crystal structure of corb
PDB Compounds: (A:) CorB

SCOPe Domain Sequences for d4yufa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yufa1 c.95.1.0 (A:6-185) automated matches {Corallococcus coralloides [TaxId: 184914]}
vfplpfkiaglgryvpadvvlssdlekkydlppgwcvekqgirerrwvkdetasfmgaea
akeavrdaglkledidliinasgspeqavpdggplvqrelglgrsgvpsitvnasclsff
valdvaanylnmrrykrilivssdissvaldfrkpenftlfgdaaaaavvtlpepgeksc

SCOPe Domain Coordinates for d4yufa1:

Click to download the PDB-style file with coordinates for d4yufa1.
(The format of our PDB-style files is described here.)

Timeline for d4yufa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4yufa2