SCOPe 2.08: Domain d4yyyb2: 4yyy B:71-335

Lineage for d4yyyb2 (4yyy B:71-335)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.27: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52417] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; Rossmann-like

4. Superfamily c.27.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52418] (2 families)
   automatically mapped to Pfam PF00591

5. Family c.27.1.1: Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain [52419] (4 proteins)

6. Protein automated matches [254642] (4 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [311466] (3 PDB entries)

8. Domain d4yyyb2: 4yyy B:71-335 [312205]
   Other proteins in same PDB: d4yyya1, d4yyya3, d4yyyb1, d4yyyb3
   automated match to d4x46b2
   complexed with cit, pge, uri

Details for d4yyyb2

PDB Entry: 4yyy, 2.43 Å

PDB Description: x-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with uridine

PDB Compounds: (B:) thymidine phosphorylase

SCOPe Domain Sequences for d4yyyb2:

Sequence; same for both SEQRES and ATOM records:

>d4yyyb2 c.27.1.1 (B:71-335) automated matches {Salmonella typhimurium [TaxId: 99287]}
dwkslnlngpivdkhstggvgdvtslmlgpmvaacggyvpmisgrglghtggtldkleai
pgfdifpddnrfreiiqdvgvaiigqtsslapadkrfyatrditatvdsiplitgsilak
klaegldalvmdvkvgsgafmptyelsealaeaivgvangagvrttalltdmnqvlassa
gnavevreavqfltgeyrnprlfdvtmalcvemlisgqlakddaearaklqavldngkaa
evfgrmvaaqkgpsdfvenydkylp

Timeline for d4yyyb2:

• d4yyyb2 first appeared in SCOPe 2.06
  
• d4yyyb2 appears in SCOPe 2.07