Lineage for d4yyyb1 (4yyy B:1-70)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323256Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 2323267Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. 2323327Family a.46.2.0: automated matches [254276] (1 protein)
    not a true family
  6. 2323328Protein automated matches [254641] (5 species)
    not a true protein
  7. 2323344Species Salmonella typhimurium [TaxId:99287] [311465] (3 PDB entries)
  8. 2323350Domain d4yyyb1: 4yyy B:1-70 [312204]
    Other proteins in same PDB: d4yyya2, d4yyya3, d4yyyb2, d4yyyb3
    automated match to d4x46b1
    complexed with cit, pge, uri

Details for d4yyyb1

PDB Entry: 4yyy (more details), 2.43 Å

PDB Description: x-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with uridine
PDB Compounds: (B:) thymidine phosphorylase

SCOPe Domain Sequences for d4yyyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yyyb1 a.46.2.0 (B:1-70) automated matches {Salmonella typhimurium [TaxId: 99287]}
mflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
mamrdsgtvl

SCOPe Domain Coordinates for d4yyyb1:

Click to download the PDB-style file with coordinates for d4yyyb1.
(The format of our PDB-style files is described here.)

Timeline for d4yyyb1: