| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) ![]() automatically mapped to Pfam PF02885 |
| Family a.46.2.0: automated matches [254276] (1 protein) not a true family |
| Protein automated matches [254641] (6 species) not a true protein |
| Species Salmonella typhimurium [TaxId:99287] [311465] (3 PDB entries) |
| Domain d4yyyb1: 4yyy B:1-70 [312204] Other proteins in same PDB: d4yyya2, d4yyya3, d4yyyb2, d4yyyb3 automated match to d4x46b1 complexed with cit, pge, uri |
PDB Entry: 4yyy (more details), 2.43 Å
SCOPe Domain Sequences for d4yyyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yyyb1 a.46.2.0 (B:1-70) automated matches {Salmonella typhimurium [TaxId: 99287]}
mflaqeiirkkrdghalsdeeirffingirdntisegqiaalamtiffhdmtmpervslt
mamrdsgtvl
Timeline for d4yyyb1: