Lineage for d4yy0f_ (4yy0 F:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2267375Protein automated matches [254646] (34 species)
    not a true protein
  7. 2267696Species Unidentified influenza virus [TaxId:119212] [312202] (5 PDB entries)
  8. 2267701Domain d4yy0f_: 4yy0 F: [312203]
    Other proteins in same PDB: d4yy0a_, d4yy0c_, d4yy0e_
    automated match to d3s12b_
    complexed with 5ax

Details for d4yy0f_

PDB Entry: 4yy0 (more details), 2.59 Å

PDB Description: the structure of hemagglutinin from a h6n1 influenza virus (a/chicken/taiwan/a2837/2013)
PDB Compounds: (F:) ha2

SCOPe Domain Sequences for d4yy0f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yy0f_ h.3.1.1 (F:) automated matches {Unidentified influenza virus [TaxId: 119212]}
gifgaiagfieggwtgmidgwygyhhensqgsgyaadrestqkaidgitnkvnsiinkmn
tqfeavdhefsnlerrignlnkrmedgfldvwtynaellvllenertldlhdanvknlye
kvksqlrdnandlgngcfefwhkcdnecmesvkngtydy

SCOPe Domain Coordinates for d4yy0f_:

Click to download the PDB-style file with coordinates for d4yy0f_.
(The format of our PDB-style files is described here.)

Timeline for d4yy0f_: