Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (83 species) not a true protein |
Species Corallococcus coralloides [TaxId:184914] [312199] (3 PDB entries) |
Domain d4yuca1: 4yuc A:6-185 [312200] automated match to d4v2pa1 complexed with mpd, na |
PDB Entry: 4yuc (more details), 1.31 Å
SCOPe Domain Sequences for d4yuca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yuca1 c.95.1.0 (A:6-185) automated matches {Corallococcus coralloides [TaxId: 184914]} vfplpfkiaglgryvpadvvlssdlekkydlppgwcvekqgirerrwvkdetasfmgaea akeavrdaglkledidliinasgspeqavpdggplvqrelglgrsgvpsitvnasclsff valdvaanylnmrrykrilivssdissvaldfrkpenftlfgdaaaaavvtlpepgeksc
Timeline for d4yuca1: