SCOPe 2.07: Domain d4ypob2: 4ypo B:181-325

Lineage for d4ypob2 (4ypo B:181-325)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.0: automated matches [227147] (1 protein)
   not a true family

6. Protein automated matches [226851] (37 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [312097] (1 PDB entry)

8. Domain d4ypob2: 4ypo B:181-325 [312194]
   Other proteins in same PDB: d4ypoa1, d4ypob1
   automated match to d4kqxb2
   complexed with cl, mg, na

Details for d4ypob2

PDB Entry: 4ypo, 1 Å

PDB Description: crystal structure of mycobacterium tuberculosis ketol-acid reductoisomerase in complex with mg2+

PDB Compounds: (B:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4ypob2:

Sequence; same for both SEQRES and ATOM records:

>d4ypob2 a.100.1.0 (B:181-325) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
fkdetetdlfgeqtvlcggteelvkagfevmveagypaelayfevlhelklivdlmyegg
larmyysvsdtaefggylsgprvidagtkermrdilreiqdgsfvhklvadveggnkqle
elrrqnaehpievvgkklrdlmswv

Timeline for d4ypob2:

• d4ypob2 first appeared in SCOPe 2.06