| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [186788] (2 PDB entries) |
| Domain d4ypob1: 4ypo B:1-180 [312193] Other proteins in same PDB: d4ypoa2, d4ypob2 automated match to d4kqxb1 complexed with cl, mg, na |
PDB Entry: 4ypo (more details), 1 Å
SCOPe Domain Sequences for d4ypob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ypob1 c.2.1.0 (B:1-180) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mfydddadlsiiqgrkvgvigygsqghahslslrdsgvqvrvglkqgsrsrpkveeqgld
vdtpaevakwadvvmvlapdtaqaeifagdiepnlkpgdalffghglnvhfglikppadv
avamvapkgpghlvrrqfvdgkgvpclvaveqdprgdglalalsyakaiggtragviktt
Timeline for d4ypob1: