Lineage for d4yn5a_ (4yn5 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2417234Family c.1.8.3: beta-glycanases [51487] (27 protein domains)
    consist of a number of sequence families
  6. 2417701Protein Mannanase A, ManA [63908] (3 species)
  7. 2417702Species Bacillus sp. [TaxId:253629] [346273] (1 PDB entry)
  8. 2417703Domain d4yn5a_: 4yn5 A: [312189]
    automated match to d2whma_
    complexed with cac

Details for d4yn5a_

PDB Entry: 4yn5 (more details), 1.8 Å

PDB Description: catalytic domain of bacillus sp. jamb-750 gh26 endo-beta-1,4-mannanase
PDB Compounds: (A:) mannan endo-1,4-beta-mannosidase

SCOPe Domain Sequences for d4yn5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yn5a_ c.1.8.3 (A:) Mannanase A, ManA {Bacillus sp. [TaxId: 253629]}
ipkdsegqsfklvdsnastltkslyaylqdtsgrqilfghqhavdegltltnsgdrvgst
qsevknavgdypaifgwdtlsldgyekpgneknsqaqnranvvqsmrtvhelggiialsm
hpenfvtgnqyndtsgdvvknilpdgshhevfnawldniaafaheltdqstgelipvifr
pfheqnggwfwwgaqtttaseykalyrytvdylrdvkgvnnflyafspnapfdgnltqyl
rtypgdqyvdifgldqydnkanagqatflngltqdlamiskladekgkiaafteygyspq
gfnetgnylqwytavleaikkdpnasriaymqtwanfgyptnmfvpyrdvngnlggdhel
lpnfvefyeddyaaflteasgwnlyqdisti

SCOPe Domain Coordinates for d4yn5a_:

Click to download the PDB-style file with coordinates for d4yn5a_.
(The format of our PDB-style files is described here.)

Timeline for d4yn5a_: