Lineage for d4yvbc_ (4yvb C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2396657Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2396658Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. 2396659Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. 2396981Protein automated matches [190191] (2 species)
    not a true protein
  7. 2397072Species Streptomyces avidinii [TaxId:1895] [189343] (64 PDB entries)
  8. 2397118Domain d4yvbc_: 4yvb C: [312187]
    automated match to d3ry1b_
    complexed with btn

Details for d4yvbc_

PDB Entry: 4yvb (more details), 1.35 Å

PDB Description: structure of d128n streptavidin
PDB Compounds: (C:) streptavidin

SCOPe Domain Sequences for d4yvbc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yvbc_ b.61.1.1 (C:) automated matches {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghntftkv

SCOPe Domain Coordinates for d4yvbc_:

Click to download the PDB-style file with coordinates for d4yvbc_.
(The format of our PDB-style files is described here.)

Timeline for d4yvbc_: