Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d4xbgl2: 4xbg L:107-213 [312186] Other proteins in same PDB: d4xbgb1, d4xbgd1, d4xbgf1, d4xbgi1, d4xbgk1, d4xbgl1 automated match to d1dn0a2 complexed with 44e, gol, po4, unl |
PDB Entry: 4xbg (more details), 2.73 Å
SCOPe Domain Sequences for d4xbgl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xbgl2 b.1.1.2 (L:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d4xbgl2: