Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (63 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:1191475] [311877] (1 PDB entry) |
Domain d4y0wc1: 4y0w C:1-108 [312183] automated match to d4yduc1 complexed with na |
PDB Entry: 4y0w (more details), 2.5 Å
SCOPe Domain Sequences for d4y0wc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4y0wc1 c.55.1.0 (C:1-108) automated matches {Pseudomonas aeruginosa [TaxId: 1191475]} mstllaldtsteacsvallhegralshyeviprlhaqrllpmvrdlldeagvalsavdai afgrgpgaftgvriaigvvqglafalqrpvlavsdlailaqrayreqg
Timeline for d4y0wc1: