Lineage for d1qrdb_ (1qrd B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 21933Superfamily c.23.5: Flavoproteins [52218] (3 families) (S)
  5. 22012Family c.23.5.3: Quinone reductase [52235] (2 proteins)
  6. 22013Protein NAD(P)H:quinone reductase [52236] (3 species)
  7. 22032Species Rat (Rattus rattus) [TaxId:10117] [52238] (1 PDB entry)
  8. 22034Domain d1qrdb_: 1qrd B: [31218]

Details for d1qrdb_

PDB Entry: 1qrd (more details), 2.4 Å

PDB Description: quinone reductase/fad/cibacron blue/duroquinone complex

SCOP Domain Sequences for d1qrdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrdb_ c.23.5.3 (B:) NAD(P)H:quinone reductase {Rat (Rattus rattus)}
avrralivlahaertsfnyamkeaavealkkkgwevvesdlyamnfnplisrnditgepk
dsenfqypvesslaykegrlspdivaeqkkleaadlvifqfplywfgvpailkgwfervl
vagfaytyatmydkgpfqnkktllsittggsgsmyslqgvhgdmnvilwpiqsgilrfcg
fqvlepqlvysightppdarvqvlegwkkrletvweesplyfapsslfdlnfqagfllkk
evqeeqkknkfglsvghhlgksipadnqikark

SCOP Domain Coordinates for d1qrdb_:

Click to download the PDB-style file with coordinates for d1qrdb_.
(The format of our PDB-style files is described here.)

Timeline for d1qrdb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1qrda_