| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
| Protein automated matches [190824] (31 species) not a true protein |
| Species Alcaligenes faecalis [TaxId:511] [226762] (16 PDB entries) |
| Domain d4yscc2: 4ysc C:162-338 [312175] automated match to d2e86a2 complexed with cl, cu |
PDB Entry: 4ysc (more details), 2.03 Å
SCOPe Domain Sequences for d4yscc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4yscc2 b.6.1.0 (C:162-338) automated matches {Alcaligenes faecalis [TaxId: 511]}
lhdgkgkaltydkiyyvgeqdfyvprdengkykkyeapgdayedtvkvmrtltpthvvfn
gavgaltgdkamtaavgekvlivhsqanrdtrphligghgdyvwatgkfntppdvdqetw
fipggaagaafytfqqpgiyayvnhnlieafelgaaahfkvtgewnddlmtsvlaps
Timeline for d4yscc2:
View in 3DDomains from other chains: (mouse over for more information) d4ysca1, d4ysca2, d4yscb1, d4yscb2 |