Lineage for d4y92a1 (4y92 A:85-139)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392985Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2392986Protein automated matches [190457] (10 species)
    not a true protein
  7. 2392989Species Avian sarcoma virus pr2257/16 [TaxId:385048] [312170] (1 PDB entry)
  8. 2392990Domain d4y92a1: 4y92 A:85-139 [312171]
    Other proteins in same PDB: d4y92a2
    automated match to d1e6ga_
    complexed with gol, pge, so4; mutant

Details for d4y92a1

PDB Entry: 4y92 (more details), 2.1 Å

PDB Description: crystal structure of the intertwined form of the src tyrosine kinase sh3 domain e97t-q128r mutant
PDB Compounds: (A:) Protein-tyrosine kinase

SCOPe Domain Sequences for d4y92a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4y92a1 b.34.2.0 (A:85-139) automated matches {Avian sarcoma virus pr2257/16 [TaxId: 385048]}
tfvalydyesrtttdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvap

SCOPe Domain Coordinates for d4y92a1:

Click to download the PDB-style file with coordinates for d4y92a1.
(The format of our PDB-style files is described here.)

Timeline for d4y92a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4y92a2