SCOPe 2.06: Domain d4y92a1: 4y92 A:85-139

Lineage for d4y92a1 (4y92 A:85-139)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Avian sarcoma virus pr2257/16 [TaxId:385048] [312170] (1 PDB entry)

8. Domain d4y92a1: 4y92 A:85-139 [312171]
   Other proteins in same PDB: d4y92a2
   automated match to d1e6ga_
   complexed with gol, pge, so4; mutant

Details for d4y92a1

PDB Entry: 4y92, 2.1 Å

PDB Description: crystal structure of the intertwined form of the src tyrosine kinase sh3 domain e97t-q128r mutant

PDB Compounds: (A:) Protein-tyrosine kinase

SCOPe Domain Sequences for d4y92a1:

Sequence; same for both SEQRES and ATOM records:

>d4y92a1 b.34.2.0 (A:85-139) automated matches {Avian sarcoma virus pr2257/16 [TaxId: 385048]}
tfvalydyesrtttdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvap

Timeline for d4y92a1:

• d4y92a1 is new in SCOPe 2.06-stable
  
• d4y92a1 appears in SCOPe 2.07
  
• d4y92a1 appears in the current release, SCOPe 2.08