Lineage for d1dxqb_ (1dxq B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 21933Superfamily c.23.5: Flavoproteins [52218] (3 families) (S)
  5. 22012Family c.23.5.3: Quinone reductase [52235] (2 proteins)
  6. 22013Protein NAD(P)H:quinone reductase [52236] (3 species)
  7. 22027Species Mouse (Mus musculus) [TaxId:10090] [52237] (1 PDB entry)
  8. 22029Domain d1dxqb_: 1dxq B: [31214]

Details for d1dxqb_

PDB Entry: 1dxq (more details), 2.8 Å

PDB Description: crystal structure of mouse nad[p]h-quinone oxidoreductase

SCOP Domain Sequences for d1dxqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxqb_ c.23.5.3 (B:) NAD(P)H:quinone reductase {Mouse (Mus musculus)}
aarralivlahsektsfnyamkeaavealkkrgwevlesdlyamnfnpiisrnditgelk
dsknfqypsesslaykegrlspdivaehkkleaadlvifqfplqwfgvpailkgwfervl
vagfaytyaamydngpfqnkktllsittggsgsmyslqgvhgdmnvilwpiqsgilrfcg
fqvlepqlvysightppdarmqilegwkkrletvweetplyfapsslfdlnfqagfllmk
evqeeqkknkfglsvghhlgksipadnqikark

SCOP Domain Coordinates for d1dxqb_:

Click to download the PDB-style file with coordinates for d1dxqb_.
(The format of our PDB-style files is described here.)

Timeline for d1dxqb_: