Lineage for d4ymza_ (4ymz A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2434696Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2435148Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2435149Protein automated matches [190605] (25 species)
    not a true protein
  7. 2435245Species Leptospira interrogans [TaxId:1291351] [311763] (2 PDB entries)
  8. 2435246Domain d4ymza_: 4ymz A: [312129]
    automated match to d3uwub_
    complexed with 13p, edo, so4

Details for d4ymza_

PDB Entry: 4ymz (more details), 1.87 Å

PDB Description: dhap bound leptospira interrogans triosephosphate isomerase (litim)
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d4ymza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ymza_ c.1.1.0 (A:) automated matches {Leptospira interrogans [TaxId: 1291351]}
arktiiagnwkmnlslkeavflahsirekipsiskdkvsmvfpstlhlenvskilegssv
ivgaqncyhsglaaftgetspdqlkeigvkvvmvghserrqflgesnffcndkirfllkn
eftvlycvgetlseresgktlevlssqireglkgidsvffsnlilayepvwaigtgkvat
psqaqevhsfirkeisglfvgassisesisilyggsvkpdniqdllkekdidgglvggas
qkissfaglf

SCOPe Domain Coordinates for d4ymza_:

Click to download the PDB-style file with coordinates for d4ymza_.
(The format of our PDB-style files is described here.)

Timeline for d4ymza_: