Lineage for d1b1ca_ (1b1c A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.5: Flavoproteins [52218] (3 families) 
Family c.23.5.2: NADPH-cytochrome p450 reductase, N-terminal domain [52231] (1 protein) Protein NADPH-cytochrome p450 reductase, N-terminal domain [52232] (2 species) Species Human (Homo sapiens) [TaxId:9606] [52234] (1 PDB entry) 
Domain d1b1ca_: 1b1c A: [31212]
Details for d1b1ca_
PDB Entry: 1b1c (more details), 1.93 Å
PDB Description: crystal structure of the fmn-binding domain of human cytochrome p450 reductase at 1.93a resolution
SCOP Domain Sequences for d1b1ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b1ca_ c.23.5.2 (A:) NADPH-cytochrome p450 reductase, N-terminal domain {Human (Homo sapiens)}
ssfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlsslp
eidnalvvfcmatygegdptdnaqdfydwlqetdvdlsgvkfavfglgnktyehfnamgk
yvdkrleqlgaqrifelglgdddgnleedfitwreqfwpavcehfgv
SCOP Domain Coordinates for d1b1ca_:
Click to download the PDB-style file with coordinates for d1b1ca_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1b1ca_:
- d1b1ca_ appears in SCOP 1.57
- d1b1ca_ appears in the current release, SCOPe 2.08
View in 3D