Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.2: Cytochrome p450 reductase N-terminal domain-like [52231] (3 proteins) |
Protein NADPH-cytochrome p450 reductase, N-terminal domain [52232] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [52234] (1 PDB entry) |
Domain d1b1ca_: 1b1c A: [31212] complexed with ca, fmn |
PDB Entry: 1b1c (more details), 1.93 Å
SCOPe Domain Sequences for d1b1ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b1ca_ c.23.5.2 (A:) NADPH-cytochrome p450 reductase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} ssfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlsslp eidnalvvfcmatygegdptdnaqdfydwlqetdvdlsgvkfavfglgnktyehfnamgk yvdkrleqlgaqrifelglgdddgnleedfitwreqfwpavcehfg
Timeline for d1b1ca_: