Lineage for d1b1ca_ (1b1c A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856501Family c.23.5.2: Cytochrome p450 reductase N-terminal domain-like [52231] (3 proteins)
  6. 2856502Protein NADPH-cytochrome p450 reductase, N-terminal domain [52232] (2 species)
  7. 2856503Species Human (Homo sapiens) [TaxId:9606] [52234] (1 PDB entry)
  8. 2856504Domain d1b1ca_: 1b1c A: [31212]
    complexed with ca, fmn

Details for d1b1ca_

PDB Entry: 1b1c (more details), 1.93 Å

PDB Description: crystal structure of the fmn-binding domain of human cytochrome p450 reductase at 1.93a resolution
PDB Compounds: (A:) protein (nadph-cytochrome p450 reductase)

SCOPe Domain Sequences for d1b1ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b1ca_ c.23.5.2 (A:) NADPH-cytochrome p450 reductase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ssfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlsslp
eidnalvvfcmatygegdptdnaqdfydwlqetdvdlsgvkfavfglgnktyehfnamgk
yvdkrleqlgaqrifelglgdddgnleedfitwreqfwpavcehfg

SCOPe Domain Coordinates for d1b1ca_:

Click to download the PDB-style file with coordinates for d1b1ca_.
(The format of our PDB-style files is described here.)

Timeline for d1b1ca_: