Class a: All alpha proteins [46456] (289 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
Protein automated matches [226851] (35 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [312097] (1 PDB entry) |
Domain d4ypoa2: 4ypo A:181-325 [312098] Other proteins in same PDB: d4ypoa1, d4ypob1 automated match to d4kqxb2 complexed with cl, mg, na |
PDB Entry: 4ypo (more details), 1 Å
SCOPe Domain Sequences for d4ypoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ypoa2 a.100.1.0 (A:181-325) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} fkdetetdlfgeqtvlcggteelvkagfevmveagypaelayfevlhelklivdlmyegg larmyysvsdtaefggylsgprvidagtkermrdilreiqdgsfvhklvadveggnkqle elrrqnaehpievvgkklrdlmswv
Timeline for d4ypoa2: