Lineage for d4ypoa1 (4ypo A:1-180)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847782Species Mycobacterium tuberculosis [TaxId:1773] [186788] (2 PDB entries)
  8. 2847783Domain d4ypoa1: 4ypo A:1-180 [312096]
    Other proteins in same PDB: d4ypoa2, d4ypob2
    automated match to d4kqxb1
    complexed with cl, mg, na

Details for d4ypoa1

PDB Entry: 4ypo (more details), 1 Å

PDB Description: crystal structure of mycobacterium tuberculosis ketol-acid reductoisomerase in complex with mg2+
PDB Compounds: (A:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4ypoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ypoa1 c.2.1.0 (A:1-180) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mfydddadlsiiqgrkvgvigygsqghahslslrdsgvqvrvglkqgsrsrpkveeqgld
vdtpaevakwadvvmvlapdtaqaeifagdiepnlkpgdalffghglnvhfglikppadv
avamvapkgpghlvrrqfvdgkgvpclvaveqdprgdglalalsyakaiggtragviktt

SCOPe Domain Coordinates for d4ypoa1:

Click to download the PDB-style file with coordinates for d4ypoa1.
(The format of our PDB-style files is described here.)

Timeline for d4ypoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ypoa2