SCOPe 2.08: Domain d4ypoa1: 4ypo A:1-180

Lineage for d4ypoa1 (4ypo A:1-180)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [186788] (2 PDB entries)

8. Domain d4ypoa1: 4ypo A:1-180 [312096]
   Other proteins in same PDB: d4ypoa2, d4ypob2
   automated match to d4kqxb1
   complexed with cl, mg, na

Details for d4ypoa1

PDB Entry: 4ypo, 1 Å

PDB Description: crystal structure of mycobacterium tuberculosis ketol-acid reductoisomerase in complex with mg2+

PDB Compounds: (A:) Ketol-acid reductoisomerase

SCOPe Domain Sequences for d4ypoa1:

Sequence; same for both SEQRES and ATOM records:

>d4ypoa1 c.2.1.0 (A:1-180) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mfydddadlsiiqgrkvgvigygsqghahslslrdsgvqvrvglkqgsrsrpkveeqgld
vdtpaevakwadvvmvlapdtaqaeifagdiepnlkpgdalffghglnvhfglikppadv
avamvapkgpghlvrrqfvdgkgvpclvaveqdprgdglalalsyakaiggtragviktt

Timeline for d4ypoa1:

• d4ypoa1 first appeared in SCOPe 2.06
  
• d4ypoa1 appears in SCOPe 2.07