SCOPe 2.07: Domain d4yq5a1: 4yq5 A:1-246

Lineage for d4yq5a1 (4yq5 A:1-246)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.4: tRNA(m1G37)-methyltransferase TrmD [89629] (2 proteins)
   fold and dimerisation mode are similar to those of the YbeA-like family; contains additional C-terminal all-alpha subdomain

6. Protein automated matches [196235] (4 species)
   not a true protein

7. Species Haemophilus influenzae [TaxId:71421] [196236] (37 PDB entries)

8. Domain d4yq5a1: 4yq5 A:1-246 [312093]
   Other proteins in same PDB: d4yq5a2
   automated match to d4mccb_
   protein/RNA complex; complexed with 4g0, flc

Details for d4yq5a1

PDB Entry: 4yq5, 1.76 Å

PDB Description: crystal structure of trmd, a m1g37 trna methyltransferase with sam- competitive compounds

PDB Compounds: (A:) tRNA (guanine-N(1)-)-methyltransferase

SCOPe Domain Sequences for d4yq5a1:

Sequence, based on SEQRES records:

>d4yq5a1 c.116.1.4 (A:1-246) automated matches {Haemophilus influenzae [TaxId: 71421]}
mwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpgm
lmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegide
rliqteideewsigdyvltggelpamtlidavarfipgvlgkqasaeedsfadglldcph
ytrpevlegltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllkea
qaehns

Sequence, based on observed residues (ATOM records):

>d4yq5a1 c.116.1.4 (A:1-246) automated matches {Haemophilus influenzae [TaxId: 71421]}
mwigvislfpemfkaitefgvtgravkhnllkvecwnprdftfdkhktvddrpygggpgm
lmmvqplrdaihtakaaagegakviylspqgrkldqggvtelaqnqklilvcgryegide
rliqteideewsigdyvltggelpamtlidavarfipgvlgsfadglldcphytrpevle
gltvppvlmsghheeirkwrlkqslqrtwlrrpelleglaltdeqrkllkeaqaehns

Timeline for d4yq5a1:

• d4yq5a1 first appeared in SCOPe 2.06
  
• d4yq5a1 appears in the current release, SCOPe 2.08