Lineage for d4yaob3 (4yao B:519-678)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442174Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2442175Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families) (S)
    binds NADP differently than classical Rossmann-fold
    N-terminal FAD-linked domain contains (6,10) barrel
  5. 2442345Family c.25.1.0: automated matches [227163] (1 protein)
    not a true family
  6. 2442346Protein automated matches [226871] (18 species)
    not a true protein
  7. 2442414Species Norway rat (Rattus norvegicus) [TaxId:10116] [256001] (15 PDB entries)
  8. 2442432Domain d4yaob3: 4yao B:519-678 [312091]
    Other proteins in same PDB: d4yaoa1, d4yaoa2, d4yaob1, d4yaob2
    automated match to d1j9za3
    complexed with 2am, fad, fmn, po4; mutant

Details for d4yaob3

PDB Entry: 4yao (more details), 2.5 Å

PDB Description: reduced cypor mutant - g143del
PDB Compounds: (B:) NADPH--cytochrome P450 reductase

SCOPe Domain Sequences for d4yaob3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yaob3 c.25.1.0 (B:519-678) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rlpfksttpvimvgpgtgiapfmgfiqerawlreqgkevgetllyygcrrsdedylyree
larfhkdgaltqlnvafsreqahkvyvqhllkrdrehlwkliheggahiyvcgdarnmak
dvqntfydivaefgpmehtqavdyvkklmtkgrysldvws

SCOPe Domain Coordinates for d4yaob3:

Click to download the PDB-style file with coordinates for d4yaob3.
(The format of our PDB-style files is described here.)

Timeline for d4yaob3: