SCOP 1.63: Domain d1e5db1: 1e5d B:251-402

Lineage for d1e5db1 (1e5d B:251-402)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (3 families)

5. Family c.23.5.1: Flavodoxin-related [52219] (3 proteins)
   binds FMN

6. Protein Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain [52229] (1 species)

7. Species Desulfovibrio gigas [TaxId:879] [52230] (1 PDB entry)

8. Domain d1e5db1: 1e5d B:251-402 [31209]
   Other proteins in same PDB: d1e5da2, d1e5db2
   complexed with feo, fmn, oxy

Details for d1e5db1

PDB Entry: 1e5d, 2.5 Å

PDB Description: rubredoxin oxygen:oxidoreductase (roo) from anaerobe desulfovibrio gigas

SCOP Domain Sequences for d1e5db1:

Sequence; same for both SEQRES and ATOM records:

>d1e5db1 c.23.5.1 (B:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas}
ptnkvvifydsmwhstekmarvlaesfrdegctvklmwckachhsqimseisdagavivg
spthnngilpyvagtlqyikglrpqnkiggafgsfgwsgestkvlaewltgmgfdmpatp
vkvknvpthadyeqlktmaqtiaralkaklaa

Timeline for d1e5db1:

• d1e5db1 first appeared (with stable ids) in SCOP 1.55
  
• d1e5db1 appears in SCOP 1.61
  
• d1e5db1 appears in SCOP 1.65
  
• d1e5db1 appears in the current release, SCOPe 2.08